PDB entry 1jc5

View 1jc5 on RCSB PDB site
Description: Crystal Structure of Native Methylmalonyl-CoA Epimerase
Deposited on 2001-06-07, released 2001-07-11
The last revision prior to the SCOP 1.63 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1jc5a_
  • Chain 'B':
    Domains in SCOP 1.63: d1jc5b_
  • Chain 'C':
    Domains in SCOP 1.63: d1jc5c_
  • Chain 'D':
    Domains in SCOP 1.63: d1jc5d_
  • Chain 'E':
    Domains in SCOP 1.63: d1jc5e_
  • Chain 'F':
    Domains in SCOP 1.63: d1jc5f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jc5A (A:)
    nedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmt
    qvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgt
    ggnrinfmhpksgkgvlieltqypk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jc5B (B:)
    msnedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaaklteh
    mtqvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepkl
    gtggnrinfmhpksgkgvlieltqypk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jc5C (C:)
    nedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmt
    qvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgt
    ggnrinfmhpksgkgvlieltqypk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jc5D (D:)
    edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq
    vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg
    gnrinfmhpksgkgvlieltqypkn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jc5E (E:)
    edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq
    vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg
    gnrinfmhpksgkgvlieltqypkn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jc5F (F:)
    edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq
    vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg
    gnrinfmhpksgkgvlieltqypk