PDB entry 1jc5

View 1jc5 on RCSB PDB site
Description: Crystal Structure of Native Methylmalonyl-CoA Epimerase
Class: isomerase
Keywords: epimerisation, methylmalonyl-CoA, vicinal oxygen chelate superfamily, metal-assisted catalysis, ISOMERASE
Deposited on 2001-06-07, released 2001-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylmalonyl-CoA Epimerase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jc5a_
  • Chain 'B':
    Compound: Methylmalonyl-CoA Epimerase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jc5b_
  • Chain 'C':
    Compound: Methylmalonyl-CoA Epimerase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jc5c_
  • Chain 'D':
    Compound: Methylmalonyl-CoA Epimerase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jc5d_
  • Chain 'E':
    Compound: Methylmalonyl-CoA Epimerase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jc5e_
  • Chain 'F':
    Compound: Methylmalonyl-CoA Epimerase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jc5f_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jc5A (A:)
    msnedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaaklteh
    mtqvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepkl
    gtggnrinfmhpksgkgvlieltqypkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jc5A (A:)
    nedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmt
    qvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgt
    ggnrinfmhpksgkgvlieltqypk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jc5B (B:)
    msnedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaaklteh
    mtqvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepkl
    gtggnrinfmhpksgkgvlieltqypkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jc5B (B:)
    msnedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaaklteh
    mtqvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepkl
    gtggnrinfmhpksgkgvlieltqypk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jc5C (C:)
    msnedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaaklteh
    mtqvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepkl
    gtggnrinfmhpksgkgvlieltqypkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jc5C (C:)
    nedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmt
    qvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgt
    ggnrinfmhpksgkgvlieltqypk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jc5D (D:)
    msnedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaaklteh
    mtqvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepkl
    gtggnrinfmhpksgkgvlieltqypkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jc5D (D:)
    edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq
    vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg
    gnrinfmhpksgkgvlieltqypkn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jc5E (E:)
    msnedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaaklteh
    mtqvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepkl
    gtggnrinfmhpksgkgvlieltqypkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jc5E (E:)
    edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq
    vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg
    gnrinfmhpksgkgvlieltqypkn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1jc5F (F:)
    msnedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaaklteh
    mtqvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepkl
    gtggnrinfmhpksgkgvlieltqypkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jc5F (F:)
    edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq
    vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg
    gnrinfmhpksgkgvlieltqypk