PDB entry 1jbt

View 1jbt on RCSB PDB site
Description: crystal structure of ribotoxin restrictocin complexed with a 29-mer sarcin/ricin domain RNA analog
Class: hydrolase/RNA
Keywords: restrictocin, ribotoxin, highly specific ribonuclease, ribonuclease T1, protein-RNA recognition, HYDROLASE/RNA COMPLEX
Deposited on 2001-06-06, released 2001-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.224
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: restrictocin
  Species: Aspergillus restrictus [TaxId:5064]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P67876 (0-148)
  Domains in SCOPe 2.08: d1jbta_
• Chain 'B':
  Compound: restrictocin
  Species: Aspergillus restrictus [TaxId:5064]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P67876 (0-148)
  Domains in SCOPe 2.08: d1jbtb_
• Chain 'C':
  Compound: 29-mer sarcin/ricin domain RNA analog
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: 29-mer sarcin/ricin domain RNA analog
  Species: synthetic, synthetic
  
• Heterogens: K

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jbtA (A:)
  atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk
  likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkedpgpar
  viytypnkvfcgivahqrgnqgdlrlcsh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jbtB (B:)
  atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk
  likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkedpgpar
  viytypnkvfcgivahqrgnqgdlrlcsh
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.