PDB entry 1jbs

View 1jbs on RCSB PDB site
Description: Crystal structure of ribotoxin restrictocin and a 29-mer SRD RNA analog
Class: hydrolase/RNA
Keywords: ribotoxin, highly specific ribonuclease, protein-RNA complex, ribonuclease T1, HYDROLASE-RNA COMPLEX
Deposited on 2001-06-06, released 2001-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: restrictocin
  Species: Aspergillus restrictus [TaxId:5064]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04389 (0-148)
  Domains in SCOPe 2.08: d1jbsa_
• Chain 'B':
  Compound: restrictocin
  Species: Aspergillus restrictus [TaxId:5064]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04389 (0-148)
  Domains in SCOPe 2.08: d1jbsb_
• Chain 'C':
  Compound: 29-mer sarcin/ricin domain RNA analog
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: 29-mer sarcin/ricin domain RNA analog
  Species: synthetic, synthetic
  
• Heterogens: K, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jbsA (A:)
  atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk
  likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkedpgpar
  viytypnkvfcgivahqrgnqgdlrlcsh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jbsB (B:)
  atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk
  likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkedpgpar
  viytypnkvfcgivahqrgnqgdlrlcsh
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.