PDB entry 1jbk

View 1jbk on RCSB PDB site
Description: Crystal Structure of the First Nucelotide Binding Domain of ClpB
Class: chaperone
Keywords: Beta barrel, CHAPERONE
Deposited on 2001-06-05, released 2002-06-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.222
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clpb protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63284 (2-194)
      • expression tag (0-1)
    Domains in SCOPe 2.01: d1jbka_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jbkA (A:)
    hmqalkkytidlteraeqgkldpvigrdeeirrtiqvlqrrtknnpvligepgvgktaiv
    eglaqriingevpeglkgrrvlaldmgalvagakyrgefeerlkgvlndlakqegnvilf
    idelhtmvgagkadgamdagnmlkpalargelhcvgattldeyrqyiekdaalerrfqkv
    fvaepsvedtiailr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jbkA (A:)
    hmqalkkytidlteraeqgkldpvigrdeeirrtiqvlqrrtknnpvligepgvgktaiv
    eglaqriingevpeglkgrrvlaldmgalvagakyrgefeerlkgvlndlakqegnvilf
    idelhtmvgamdagnmlkpalargelhcvgattldeyrqyiekdaalerrfqkvfvaeps
    vedtiailr