PDB entry 1jbj

View 1jbj on RCSB PDB site
Description: CD3 Epsilon and gamma Ectodomain Fragment Complex in Single-Chain Construct
Class: immune system
Keywords: beta-sheet, C2-set IMMUNOGLOBULIN SUPERFAMILY, H-bonded G strand pair, single-chain, IMMUNE SYSTEM
Deposited on 2001-06-05, released 2001-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD3 Epsilon and gamma Ectodomain Fragment Complex
    Species: Mus musculus [TaxId:10090]
    Gene: Cd3e FOR EPSILON CHAIN/CD3G FOR GAMMA CHAIN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22646 (0-78)
    • GB AAB09468 (79-104)
    • Uniprot P11942 (105-185)
    Domains in SCOPe 2.07: d1jbja1, d1jbja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jbjA (A:)
    ddaenieykvsisgtsveltcpldsdenlkwekngqelpqkhdkhlvlqdfsevedsgyy
    vcytpasnkntylylkarvgsaddakkdaakkddakkddakkdgsqtnkaknlvqvdgsr
    gdgsvlltcgltdktikwlkdgsiisplnatkntwnlgnnakdprgtyqcqgaketsnpl
    qvyyrm