PDB entry 1jbe

View 1jbe on RCSB PDB site
Description: 1.08 A Structure of apo-Chey reveals meta-active conformation
Class: signaling protein
Keywords: chey, chemotaxis, signaling protein
Deposited on 2001-06-04, released 2001-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.113
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06143 (0-127)
    • modified residue (73-74)
  Domains in SCOPe 2.07: d1jbea_
• Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jbeA (A:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
  nmdglellktiraxxamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm