PDB entry 1jbd

View 1jbd on RCSB PDB site
Description: NMR Structure of the Complex Between alpha-bungarotoxin and a Mimotope of the Nicotinic Acetilcholine Receptor
Class: toxin
Keywords: alpha-bungarotoxin, protein-peptide complex, achr
Deposited on 2001-06-04, released 2001-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: long neurotoxin 1
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jbda_
  • Chain 'B':
    Compound: mimotope of the nicotinic acetilcholine receptor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1JBD (0-13)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jbdA (A:)
    ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg
    

  • Chain 'B':
    No sequence available.