PDB entry 1jbb

View 1jbb on RCSB PDB site
Description: Ubiquitin Conjugating Enzyme, Ubc13
Class: ligase
Keywords: ubiquitin, ubiquitin-conjugating enzyme, e2, ligase
Deposited on 2001-06-03, released 2001-06-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin conjugating enzyme E2-17.5 KDA
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: UBC13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jbba_
  • Chain 'B':
    Compound: ubiquitin conjugating enzyme E2-17.5 KDA
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: UBC13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jbbb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jbbA (A:)
    maslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
    dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp
    landvaedwikneqgakakarewtklyakkkpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jbbA (A:)
    slpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpddy
    pmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndpla
    ndvaedwikneqgakakarewtklyakk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jbbB (B:)
    maslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
    dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp
    landvaedwikneqgakakarewtklyakkkpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jbbB (B:)
    slpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpddy
    pmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndpla
    ndvaedwikneqgakakarewtklyak