PDB entry 1jb9

View 1jb9 on RCSB PDB site
Description: Crystal Structure of The Ferredoxin:NADP+ Reductase From Maize Root AT 1.7 Angstroms
Class: oxidoreductase
Keywords: electron transport, oxidoreductase
Deposited on 2001-06-03, released 2001-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp reductase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jb9a1, d1jb9a2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jb9A (A:)
    svqqasrskvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividh
    ggnvpywegqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyyd
    petgkedpskngvcsnflcnskpgdkiqltgpsgkimllpeedpnathimiatgtgvapf
    rgylrrmfmedvpnyrfgglawlflgvansdsllydeeftsylkqypdnfrydkalsreq
    knrsggkmyvqdkieeysdeifklldggahiyfcglkgmmpgiqdtlkkvaerrgeswdq
    klaqlkknkqwhvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jb9A (A:)
    srskvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvp
    ywegqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgk
    edpskngvcsnflcnskpgdkiqltgpsgkimllpeedpnathimiatgtgvapfrgylr
    rmfmedvpnyrfgglawlflgvansdsllydeeftsylkqypdnfrydkalsreqkgkmy
    vqdkieeysdeifklldggahiyfcglkgmmpgiqdtlkkvaerrgeswdqklaqlkknk
    qwhvevy