PDB entry 1jb7

View 1jb7 on RCSB PDB site
Description: DNA G-Quartets in a 1.86 A Resolution Structure of an Oxytricha nova Telomeric Protein-DNA Complex
Class: DNA-binding protein/DNA
Keywords: telomere-binding protein, DNA-protein interactions, DNA hydration, sodium ion, quadruplex DNA
Deposited on 2001-06-02, released 2001-06-11
The last revision prior to the SCOP 1.75 freeze date was dated 2001-06-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.23
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomere-binding protein alpha subunit
    Species: Oxytricha nova
    Gene: MAC-56A
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jb7a1, d1jb7a2, d1jb7a3
  • Chain 'B':
    Compound: Telomere-binding protein beta subunit
    Species: Oxytricha nova
    Gene: MAC-41A
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jb7b_
  • Chain 'D':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*gp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*gp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*gp*gp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jb7A (A:)
    mstaakqnrstsrvskkktaapkegaakksdkghkyeyvelakasltsaqpqhfyavvid
    atfpyktnqeryicslkivdptlylkqqkgagdasdyatlvlyakrfedlpiihragdii
    rvhratlrlyngqrqfnanvfyssswalfstdkrsvtqeinnqdavsdttpfsfsskhat
    iekneisilqnlrkwanqyfssysvissdmytalnkaqaqkgdfdvvakilqvheldeyt
    nelklkdasgqvfytlslklkfphvrtgevvrirsatydetstqkkvlilshysniitfi
    qssklakelrakiqddhsvevaslkknvslnavvltevdkkhaalpstslqdlfhhadsd
    kelqaqdtfrtqfyvtkiepsdvkewvkgydrktkkssslkgasgkgdnifqvqflvkda
    stqlnnntyrvllytqdglganffnvkadnlhknadarkkledsaelltkfnsyvdavve
    rrngfylikdtkliy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jb7A (A:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
    dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
    vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytaln
    kaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirs
    atydetstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavvl
    tevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrktk
    kssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhkna
    darkkledsaelltkfnsyvdavverrngfylikdtkliy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jb7B (B:)
    mskgasapqqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffva
    pyftkeavnefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhs
    fkpnlqerlnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaag
    kkgkvdagivkasaskgdefsdfsfkegntatlkiadifvqekgkdalnkaadhtdgakv
    kggakgkgkaaakaakgkkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jb7B (B:)
    qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav
    nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer
    lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag
    ivkasaskgdefsdfsfkegntatlkiadifvqekg
    

  • Chain 'D':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.