PDB entry 1jb7

View 1jb7 on RCSB PDB site
Description: DNA G-Quartets in a 1.86 A Resolution Structure of an Oxytricha nova Telomeric Protein-DNA Complex
Deposited on 2001-06-02, released 2001-06-11
The last revision prior to the SCOP 1.65 freeze date was dated 2001-06-22, with a file datestamp of 2001-06-22.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.23
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jb7A (A:)
    mstaakqnrstsrvskkktaapkegaakksdkghkyeyvelakasltsaqpqhfyavvid
    atfpyktnqeryicslkivdptlylkqqkgagdasdyatlvlyakrfedlpiihragdii
    rvhratlrlyngqrqfnanvfyssswalfstdkrsvtqeinnqdavsdttpfsfsskhat
    iekneisilqnlrkwanqyfssysvissdmytalnkaqaqkgdfdvvakilqvheldeyt
    nelklkdasgqvfytlslklkfphvrtgevvrirsatydetstqkkvlilshysniitfi
    qssklakelrakiqddhsvevaslkknvslnavvltevdkkhaalpstslqdlfhhadsd
    kelqaqdtfrtqfyvtkiepsdvkewvkgydrktkkssslkgasgkgdnifqvqflvkda
    stqlnnntyrvllytqdglganffnvkadnlhknadarkkledsaelltkfnsyvdavve
    rrngfylikdtkliy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jb7A (A:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
    dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
    vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytaln
    kaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirs
    atydetstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavvl
    tevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrktk
    kssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhkna
    darkkledsaelltkfnsyvdavverrngfylikdtkliy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jb7B (B:)
    mskgasapqqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffva
    pyftkeavnefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhs
    fkpnlqerlnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaag
    kkgkvdagivkasaskgdefsdfsfkegntatlkiadifvqekgkdalnkaadhtdgakv
    kggakgkgkaaakaakgkkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jb7B (B:)
    qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav
    nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer
    lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag
    ivkasaskgdefsdfsfkegntatlkiadifvqekg