PDB entry 1jb6

View 1jb6 on RCSB PDB site
Description: crystal structure of dimerization domain (1-33) of hnf-1alpha
Deposited on 2001-06-01, released 2001-07-11
The last revision prior to the SCOP 1.59 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.231
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jb6a_
  • Chain 'B':
    Domains in SCOP 1.59: d1jb6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jb6A (A:)
lvsklsqlqtelmaallesglskealiqalgew

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jb6B (B:)
sklsqlqtelmaallesglskealiqal