PDB entry 1jb6

View 1jb6 on RCSB PDB site
Description: Crystal Structure of Dimerization Domain (1-33) of HNF-1alpha
Class: transcription
Keywords: Four-helix bundle, non-canonical turn, TRANSCRIPTION
Deposited on 2001-06-01, released 2001-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatocyte nuclear factor 1-alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22361
      • engineered (0)
      • engineered (12)
      • engineered (32)
    Domains in SCOPe 2.08: d1jb6a_
  • Chain 'B':
    Compound: hepatocyte nuclear factor 1-alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22361
      • engineered (12)
    Domains in SCOPe 2.08: d1jb6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jb6A (A:)
    lvsklsqlqtelmaallesglskealiqalgew
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jb6B (B:)
    lvsklsqlqtelmaallesglskealiqalgew
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jb6B (B:)
    sklsqlqtelmaallesglskealiqal