PDB entry 1jat

View 1jat on RCSB PDB site
Description: Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex
Class: ligase
Keywords: ubiquitin, ubiquitin-conjugating enzyme, E2, UEV, LIGASE
Deposited on 2001-05-31, released 2001-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.203
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-Conjugating Enzyme E2-17.5 KDA
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: UBC13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52490 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.06: d1jata1, d1jata2
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme variant MMS2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MMS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jatb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jatA (A:)
    gsaaslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelyl
    pddypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpn
    dplandvaedwikneqgakakarewtklyakkkpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jatA (A:)
    aaslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
    dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp
    landvaedwikneqgakakarewtklyakkkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jatB (B:)
    hmskvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriys
    lsidcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrke
    matpankklrqpkegetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jatB (B:)
    skvprnfrlleelekgekescsygladsdditmtkwngtilgpphsnhenriyslsidcg
    pnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkematpan
    kklrqpkegetf