PDB entry 1jat

View 1jat on RCSB PDB site
Description:
Deposited on 2001-05-31, released 2001-06-20
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-20, with a file datestamp of 2001-06-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.203
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1jata_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1jatb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jatA (A:)
    aaslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
    dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp
    landvaedwikneqgakakarewtklyakkkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jatB (B:)
    skvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriysls
    idcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkema
    tpankklrqpkegetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jatB (B:)
    skvprnfrlleelekgekescsygladsdditmtkwngtilgpphsnhenriyslsidcg
    pnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkematpan
    kklrqpkegetf