PDB entry 1jao

View 1jao on RCSB PDB site
Description: complex of 3-mercapto-2-benzylpropanoyl-ala-gly-nh2 with the catalytic domain of matrix metallo proteinase-8 (met80 form)
Class: hydrolase/hydrolase inhibitor
Keywords: METALLOPROTEASE, ZINC-ENDOPEPTIDASE, METZINCINS, hydrolase-hydrolase inhibitor complex
Deposited on 1996-03-11, released 1996-07-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.183
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: matrix metallo proteinase-8 (met80 form)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1jaoa_
  • Heterogens: 0D3, CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jaoA (A:)
    mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
    iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
    ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jaoA (A:)
    npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
    rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
    lahssdpgalmypnyafretsnyslpqddidgiqaiyg