PDB entry 1jam

View 1jam on RCSB PDB site
Description: Crystal structure of apo-form of Z. Mays CK2 protein kinase alpha subunit
Class: transferase
Keywords: protein kinase fold
Deposited on 2001-05-31, released 2002-05-31
The last revision prior to the SCOP 1.73 freeze date was dated 2002-05-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase II, alpha chain
    Species: Zea mays
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jama_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jamA (A:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaensrtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jamA (A:)
    skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
    ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
    tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
    eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
    kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
    ydhqerltaleamthpyfqqvraaens