PDB entry 1jak

View 1jak on RCSB PDB site
Description: Streptomyces plicatus beta-N-acetylhexosaminidase in Complex with (2R,3R,4S,5R)-2-acetamido-3,4-dihydroxy-5-hydroxymethyl-piperidinium chloride (IFG)
Class: hydrolase
Keywords: glycoside hydrolase, family 20, Beta-N-acetylhexosaminidase, substrate-assisted catalysis, alpha/beta barrel, isofagomine inhibitor complex
Deposited on 2001-05-30, released 2001-11-21
The last revision prior to the SCOP 1.73 freeze date was dated 2001-11-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.176
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-n-acetylhexosaminidase
    Species: Streptomyces plicatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jaka1, d1jaka2
  • Heterogens: SO4, CL, IFG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jakA (A:)
    mhhhhhhhtgaapdrkapvrptpldrvipapasvdpggapyritrgthirvddsrearrv
    gdyladllrpatgyrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglf
    hgvqtlrqllppavekdsaqpgpwlvaggtiedtpryawrsamldvsrhffgvdevkryi
    drvarykynklhlhlsddqgwriaidswprlatyggstevgggpggyytkaeykeivrya
    asrhlevvpeidmpghtnaalasyaelncdgvapplytgtkvgfsslcvdkdvtydfvdd
    vigelaaltpgrylhiggdeahstpkadfvafmkrvqpivakygktvvgwhqlagaepve
    galvqywgldrtgdaekaevaeaarngtglilspadrtyldmkytkdtplglswagyvev
    qrsydwdpagylpgapadavrgveaplwtetlsdpdqldymafprlpgvaelgwspasth
    dwdtykvrlaaqapyweaagidfyrspqvpwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jakA (A:)
    drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
    yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
    vekdsaqpgpwlvaggtiedtpryawrsamldvsrhffgvdevkryidrvarykynklhl
    hlsddqgwriaidswprlatyggstevgggpggyytkaeykeivryaasrhlevvpeidm
    pghtnaalasyaelncdgvapplytgtkvgfsslcvdkdvtydfvddvigelaaltpgry
    lhiggdeahstpkadfvafmkrvqpivakygktvvgwhqlagaepvegalvqywgldrtg
    daekaevaeaarngtglilspadrtyldmkytkdtplglswagyvevqrsydwdpagylp
    gapadavrgveaplwtetlsdpdqldymafprlpgvaelgwspasthdwdtykvrlaaqa
    pyweaagidfyrspqvpwt