PDB entry 1jaj

View 1jaj on RCSB PDB site
Description: solution structure of dna polymerase x from the african swine fever virus
Deposited on 2001-05-30, released 2001-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 2001-11-07, with a file datestamp of 2001-11-07.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1jaja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jajA (A:)
    mltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdlliivpekk
    llkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhftgpv
    syliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl