PDB entry 1jai

View 1jai on RCSB PDB site
Description: h-ras p21 protein mutant g12p, complexed with guanosine-5'-[beta,gamma-methylene] triphosphate and manganese
Class: GTP-binding
Keywords: GTP hydrolysis, signal transduction, cancer, g-domain, GTP-binding
Deposited on 1996-12-15, released 1997-07-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-ha-ras
    Species: Homo sapiens [TaxId:9606]
    Gene: H-RAS-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (11)
    Domains in SCOPe 2.01: d1jaia_
  • Heterogens: MN, GCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jaiA (A:)
    mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh