PDB entry 1jae

View 1jae on RCSB PDB site
Description: structure of tenebrio molitor larval alpha-amylase
Class: glycosidase
Keywords: glycosidase, alpha-amylase, carbohydrate metabolism, alpha-1, 4-glucan-4-glucanohydrolase, hydrolase
Deposited on 1997-09-30, released 1998-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Tenebrio molitor [TaxId:7067]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jaea1, d1jaea2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jaeA (A:)
    ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery
    qpvsyiintrsgdesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny
    pavpygsgdfhspcevnnyqdadnvrncelvglrdlnqgsdyvrgvlidymnhmidlgva
    gfrvdaakhmspgdlsvifsglknlntdygfadgarpfiyqevidlggeaiskneytgfg
    cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk
    npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc
    ehrwrqvygmvgfrnavegtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglp
    agtycdvisgelsggsctgksvtvgdngsadislgsaeddgvlaihvnakl