PDB entry 1ja9

View 1ja9 on RCSB PDB site
Description: Crystal structure of 1,3,6,8-tetrahydroxynaphthalene reductase in complex with NADPH and pyroquilon
Class: oxidoreductase
Keywords: protein-NADPH-active site inhibitor complex, oxidoreductase, short chain dehydrogenase
Deposited on 2001-05-30, released 2001-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.189
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,3,6,8-tetrahydroxynaphthalene reductase
    Species: Magnaporthe grisea [TaxId:148305]
    Gene: RICE BLAST FUNGUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HFV6 (Start-273)
      • conflict (25)
    Domains in SCOPe 2.07: d1ja9a_
  • Heterogens: NDP, PYQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ja9A (A:)
    mapsaditssgpsdaskplagkvalttgagrgigrgiaielgrrgasvvvnygssskaae
    evvaelkklgaqgvaiqadiskpsevvalfdkavshfggldfvmsnsgmevwcdelevtq
    elfdkvfnlntrgqffvaqqglkhcrrggriiltssiaavmtgipnhalyagskaavegf
    crafavdcgakgvtvnciapggvktdmfdenswhyapggykgmpqekideglanmnplkr
    igypadigravsalcqeesewingqvikltgggi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ja9A (A:)
    skplagkvalttgagrgigrgiaielgrrgasvvvnygssskaaeevvaelkklgaqgva
    iqadiskpsevvalfdkavshfggldfvmsnsgmevwcdelevtqelfdkvfnlntrgqf
    fvaqqglkhcrrggriiltssiaavmtgipnhalyagskaavegfcrafavdcgakgvtv
    nciapggvktdmfdenswhyapggykgmpqekideglanmnplkrigypadigravsalc
    qeesewingqvikltgggi