PDB entry 1ja8

View 1ja8 on RCSB PDB site
Description: Kinetic Analysis of Product Inhibition in Human Manganese Superoxide Dismutase
Class: oxidoreductase
Keywords: manganese, superoxide, disumtase, SOD, MnSOD, homo sapien, alpha-beta, two-domain, homotetramer, hydrogen bond network, OXIDOREDUCTASE
Deposited on 2001-05-29, released 2001-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.243
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (160)
    Domains in SCOPe 2.07: d1ja8a1, d1ja8a2
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (160)
    Domains in SCOPe 2.07: d1ja8b1, d1ja8b2
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ja8A (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvaehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ja8B (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvaehayylqyknvrpdylkai
    wnvinwenvterymackk