PDB entry 1ja3

View 1ja3 on RCSB PDB site
Description: Crystal Structure of the Murine NK Cell Inhibitory Receptor Ly-49I
Deposited on 2001-05-29, released 2002-07-17
The last revision prior to the SCOP 1.67 freeze date was dated 2002-07-17, with a file datestamp of 2002-07-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.333
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ja3a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ja3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ja3A (A:)
    tgrgvkywfcygtkcyyfimnkttwsgckancqhysvpivkiededelkflqrhvipegy
    wiglsydkkkkewawidngpskfdmkirkmnfksrgcvflskariedtdcnipyycicgk
    kldkfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ja3A (A:)
    vkywfcygtkcyyfimnkttwsgckancqhysvpivkiededelkflqrhvipegywigl
    sydkkkkewawidngpskfdmksrgcvflskariedtdcnipyycicgkkldkfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ja3B (B:)
    tgrgvkywfcygtkcyyfimnkttwsgckancqhysvpivkiededelkflqrhvipegy
    wiglsydkkkkewawidngpskfdmkirkmnfksrgcvflskariedtdcnipyycicgk
    kldkfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ja3B (B:)
    vkywfcygtkcyyfimnkttwsgckancqhysvpivkiededelkflqrhvipegywigl
    sydkkkkewawidnkfdmkfksrgcvflskariedtdcnipyycicgkkldkf