PDB entry 1j9o

View 1j9o on RCSB PDB site
Description: solution structure of human lymphotactin
Deposited on 2001-05-28, released 2001-10-24
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-24, with a file datestamp of 2001-10-24.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1j9oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j9oA (A:)
vgsevsdkrtcvslttqrlpvsriktytitegslravifitkrglkvcadpqatwvrdvv
rsmdrksntrnnmiqtkptgtqqstntavtltg