PDB entry 1j9m

View 1j9m on RCSB PDB site
Description: K38H mutant of Streptomyces K15 DD-transpeptidase
Class: hydrolase
Keywords: penicillin-binding, DD-transpeptidase, serine peptidase, beta-lactamase, hydrolase carboxypeptidase, HYDROLASE
Deposited on 2001-05-28, released 2001-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.218
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dd-transpeptidase
    Species: Streptomyces sp. [TaxId:1958]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39042 (Start-261)
      • engineered (37)
      • conflict (70-71)
      • conflict (112-113)
      • conflict (155)
    Domains in SCOPe 2.08: d1j9ma_
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j9mA (A:)
    vtkptiaavggyamnngtgttlytkaadtrrstgstthimtakvvlaqsnlnldakvtiq
    kaysdyvvannasqahlivgdkvtvrqllyglmlpsgcdaayaladkygsgstraarvks
    figkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkayt
    aktvtktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvl
    astsiparesdatkimnygfal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j9mA (A:)
    kptiaavggyamnngtgttlytkaadtrrstgstthimtakvvlaqsnlnldakvtiqka
    ysdyvvannasqahlivgdkvtvrqllyglmlpsgcdaayaladkygsgstraarvksfi
    gkmntaatnlglhnthfdsfdgganystprdltkiassamknstfrtvvktkaytaktvt
    ktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvlastsi
    paresdatkimnygfal