PDB entry 1j9e

View 1j9e on RCSB PDB site
Description: Low Temperature (100K) Crystal Structure of Flavodoxin D. vulgaris S35C Mutant at 1.44 Angstrom Resolution
Class: electron transport
Keywords: alpha-helices, beta-sheets, ELECTRON TRANSPORT
Deposited on 2001-05-25, released 2001-09-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.139
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
      • see remark 999 (0)
      • engineered (33)
    Domains in SCOPe 2.01: d1j9ea_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j9eA (A:)
    akalivygsttgnteytaetiareladagyevdcrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai