PDB entry 1j9e

View 1j9e on RCSB PDB site
Description: low temperature (100k) crystal structure of flavodoxin d. vulgaris s35c mutant at 1.44 angstrom resolution
Deposited on 2001-05-25, released 2001-09-05
The last revision prior to the SCOP 1.59 freeze date was dated 2001-09-05, with a file datestamp of 2001-09-05.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.139
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1j9ea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j9eA (A:)
  akalivygsttgnteytaetiareladagyevdcrdaasveagglfegfdlvllgcstwg
  ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
  dglridgdpraarddivgwahdvrgai