PDB entry 1j98

View 1j98 on RCSB PDB site
Description: The 1.2 Angstrom Structure of Bacillus subtilis LuxS
Class: signaling protein
Keywords: Autoinducer synthesis, SIGNALING PROTEIN
Deposited on 2001-05-24, released 2001-06-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.127
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: autoinducer-2 production protein luxs
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34667 (Start-156)
      • modified residue (83)
      • engineered (95)
    Domains in SCOPe 2.05: d1j98a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j98A (A:)
    mpsvesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehll
    aftirshaekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipa
    anekqcgqaklhdlegakrlmrfwlsqdkeellkvfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j98A (A:)
    vesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaft
    irshaekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipaane
    kqcgqaklhdlegakrlmrfwlsqdkeellkvfg