PDB entry 1j97

View 1j97 on RCSB PDB site
Description: Phospho-Aspartyl Intermediate Analogue of Phosphoserine phosphatase
Class: hydrolase
Keywords: Phosphoserine phosphatase, PSP, phospho-Aspartyl, Beryllium Fluoride, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, HYDROLASE
Deposited on 2001-05-24, released 2001-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.189
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoserine Phosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58989
      • modified residue (10)
    Domains in SCOPe 2.08: d1j97a_
  • Chain 'B':
    Compound: Phosphoserine Phosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58989 (Start-210)
      • modified residue (10)
    Domains in SCOPe 2.08: d1j97b_
  • Heterogens: MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j97A (A:)
    mekkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsll
    kdlpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafa
    nrlivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkagl
    kiafcakpilkekadiciekrdlreilkyik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j97A (A:)
    ekkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllk
    dlpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafan
    rlivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglk
    iafcakpilkekadiciekrdlreilkyik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j97B (B:)
    mekkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsll
    kdlpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafa
    nrlivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkagl
    kiafcakpilkekadiciekrdlreilkyik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j97B (B:)
    kkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllkd
    lpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafanr
    livkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglki
    afcakpilkekadiciekrdlreilkyik