PDB entry 1j96

View 1j96 on RCSB PDB site
Description: Human 3alpha-HSD type 3 in Ternary Complex with NADP and Testosterone
Class: oxidoreductase
Keywords: Aldo-keto reductase, steroid metabolism, OXIDOREDUCTASE
Deposited on 2001-05-23, released 2002-05-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.181
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3alpha-hydroxysteroid dehydrogenase type 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52895 (1-322)
      • cloning artifact (0)
    Domains in SCOPe 2.05: d1j96a_
  • Chain 'B':
    Compound: 3alpha-hydroxysteroid dehydrogenase type 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52895 (1-322)
      • cloning artifact (0)
    Domains in SCOPe 2.05: d1j96b_
  • Heterogens: ACT, NAP, TES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j96A (A:)
    ddskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeq
    vglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpv
    svkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkp
    glkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidgln
    rnvryltldifagppnypfsdey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j96B (B:)
    ddskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeq
    vglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpv
    svkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkp
    glkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidgln
    rnvryltldifagppnypfsdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j96B (B:)
    ddskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeq
    vglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpv
    svkpgeevipkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpglkyk
    pvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlcala
    kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrnvry
    ltldifagppnypfsdey