PDB entry 1j95

View 1j95 on RCSB PDB site
Description: KCSA potassium channel with TBA (tetrabutylammonium) and potassium
Class: membrane protein
Keywords: membrane protein, metal transport
Deposited on 2001-05-23, released 2001-06-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.298
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (89)
    Domains in SCOPe 2.03: d1j95a_
  • Chain 'B':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (89)
    Domains in SCOPe 2.03: d1j95b_
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (89)
    Domains in SCOPe 2.03: d1j95c_
  • Chain 'D':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (89)
    Domains in SCOPe 2.03: d1j95d_
  • Heterogens: K, TBA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j95A (A:)
    mppmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j95A (A:)
    lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
    vtlwgrcvavvvmvagitsfglvtaalatwfvgreqer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j95B (B:)
    mppmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j95B (B:)
    lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
    vtlwgrcvavvvmvagitsfglvtaalatwfvgreqer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j95C (C:)
    mppmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j95C (C:)
    lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
    vtlwgrcvavvvmvagitsfglvtaalatwfvgreqer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j95D (D:)
    mppmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j95D (D:)
    lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
    vtlwgrcvavvvmvagitsfglvtaalatwfvgreqer