PDB entry 1j94

View 1j94 on RCSB PDB site
Description: crystal structure of lactose synthase, complex with udp
Class: transferase activator/transferase
Keywords: lactose synthase, crystal structure, MAD methods
Deposited on 2001-05-23, released 2001-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-04-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29752
      • conflict (2)
      • conflict (14)
      • conflict (37)
      • conflict (56)
      • conflict (95)
      • conflict (109)
    Domains in SCOPe 2.07: d1j94a_
  • Chain 'B':
    Compound: beta-1,4-galactosyltransferase
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037
      • cloning artifact (15)
      • conflict (28)
      • cloning artifact (44)
      • conflict (57)
      • cloning artifact (95)
      • cloning artifact (128)
      • cloning artifact (147)
      • cloning artifact (200)
      • cloning artifact (214)
      • cloning artifact (240)
      • cloning artifact (251)
    Domains in SCOPe 2.07: d1j94b_
  • Chain 'C':
    Compound: alpha-lactalbumin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29752 (0-122)
      • conflict (2)
      • conflict (14)
      • conflict (37)
      • conflict (56)
      • conflict (95)
      • cloning artifact (109)
    Domains in SCOPe 2.07: d1j94c_
  • Chain 'D':
    Compound: beta-1,4-galactosyltransferase
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-272)
      • cloning artifact (45)
      • conflict (58)
      • cloning artifact (74)
      • conflict (87)
      • cloning artifact (125)
      • cloning artifact (148)
      • cloning artifact (177)
      • cloning artifact (230)
      • cloning artifact (244)
      • cloning artifact (270)
    Domains in SCOPe 2.07: d1j94d1, d1j94d2
  • Heterogens: CA, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j94A (A:)
    teftkckvshaikdmdgyqgisllewacvlfhtsgydsqavvndngsteyglfqiserfw
    ckssefpesenicgiscdkllddeldddiacakkivaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j94B (B:)
    sltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfr
    nrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfv
    fsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpn
    nywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtket
    mlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j94B (B:)
    tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
    qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
    dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
    wgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketml
    sdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j94C (C:)
    teftkckvshaikdmdgyqgisllewacvlfhtsgydsqavvndngsteyglfqiserfw
    ckssefpesenicgiscdkllddeldddiacakkivaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j94D (D:)
    sltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfr
    nrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfv
    fsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpn
    nywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtket
    mlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j94D (D:)
    tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
    qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
    dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
    wgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketml
    sdglnsltymvlevqryplytkitvdigtps