PDB entry 1j90

View 1j90 on RCSB PDB site
Description: Crystal Structure of Drosophila Deoxyribonucleoside Kinase
Deposited on 2001-05-23, released 2001-11-28
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-28, with a file datestamp of 2001-11-28.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.26
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1j90a_
  • Chain 'B':
    Domains in SCOP 1.59: d1j90b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j90A (A:)
    tqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmykdpkkwa
    mpfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmyntleewyk
    fieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwlihqrrp
    qsckvlvldadlnle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j90B (B:)
    tqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmykdpkkwa
    mpfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmyntleewyk
    fieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwlihqrrp
    qsckvlvldad