PDB entry 1j8w

View 1j8w on RCSB PDB site
Description: crystal structure of lactose synthase, complex with glucose
Class: transferase/transferase
Keywords: lactose synhtase, glucose binding, conformational change
Deposited on 2001-05-23, released 2001-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-04-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29752
      • conflict (14)
      • conflict (26)
      • conflict (37)
      • conflict (56)
      • conflict (89)
      • conflict (95)
    Domains in SCOPe 2.07: d1j8wa_
  • Chain 'B':
    Compound: beta-1,4-galactosyltransferase
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037
      • conflict (28)
      • conflict (57)
    Domains in SCOPe 2.07: d1j8wb1, d1j8wb2
  • Chain 'C':
    Compound: alpha-lactalbumin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29752 (0-122)
      • conflict (14)
      • conflict (26)
      • conflict (37)
      • conflict (56)
      • conflict (89)
      • conflict (95)
    Domains in SCOPe 2.07: d1j8wc_
  • Chain 'D':
    Compound: beta-1,4-galactosyltransferase
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-272)
      • conflict (28)
      • conflict (57)
    Domains in SCOPe 2.07: d1j8wd_
  • Heterogens: GLC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j8wA (A:)
    teltkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
    ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j8wB (B:)
    sltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfr
    nrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfv
    fsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpn
    nywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtket
    mlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j8wB (B:)
    tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
    qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
    dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
    wgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketml
    sdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j8wC (C:)
    teltkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
    ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j8wD (D:)
    sltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfr
    nrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfv
    fsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpn
    nywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtket
    mlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j8wD (D:)
    tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
    qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
    dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
    wgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketml
    sdglnsltymvlevqryplytkitvdigtps