PDB entry 1j8v

View 1j8v on RCSB PDB site
Description: Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside
Class: hydrolase
Keywords: 2-domain fold, ligand-protein complex
Deposited on 2001-05-22, released 2002-06-12
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-d-glucan glucohydrolase isoenzyme exo1
    Species: HORDEUM VULGARE
    Database cross-references and differences (RAF-indexed):
    • GB AAD23382 (0-End)
      • see remark 999 (319)
    Domains in SCOP 1.75: d1j8va1, d1j8va2
  • Heterogens: LAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j8vA (A:)
    dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
    prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
    pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
    qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
    amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
    sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
    npyadpamaeqlgkqehrdlareaarkslvllkngktstdapllplpkkapkilvagsha
    dnlgyqcggwtiewqgdtgrttvgttileavkaavdpstvvvfaenpdaefvksggfsya
    ivavgehpytetkgdnlnltipepglstvqavcggvrcatvlisgrpvvvqpllaasdal
    vaawlpgsegqgvtdalfgdfgftgrlprtwfksvdqlpmnvgdahydplfrlgyglttn
    atkky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j8vA (A:)
    dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
    prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
    pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
    qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
    amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
    sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
    npyadpamaeqlgkqehrdlareaarkslvllkngktstdapllplpkkapkilvagsha
    dnlgyqcggwtiewqgdtgrttvgttileavkaavdpstvvvfaenpdaefvksggfsya
    ivavgehpytetkgdnlnltipepglstvqavcggvrcatvlisgrpvvvqpllaasdal
    vaawlpgsegqgvtdalfgdfgftgrlprtwfksvdqlpmnvgdahydplfrlgyglttn
    at