PDB entry 1j8s

View 1j8s on RCSB PDB site
Description: papg adhesin receptor binding domain-unbound form
Class: structural protein
Keywords: PapG adhesin, receptor
Deposited on 2001-05-22, released 2001-06-22
The last revision prior to the SCOP 1.73 freeze date was dated 2001-06-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.232
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyelonephritic adhesin
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1j8sa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j8sA (A:)
wnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgfwayyrey
iawvvfpkkvmtqngyplfievhnkgswseentgdndsyfflkgykwderafdagnlcqk
pgeitrltekfddiifkvalpadlplgdysvkipytsgmqrhfasylgarfkipynvakt
lprenemlflfknigg