PDB entry 1j8r

View 1j8r on RCSB PDB site
Description: binary complex of the papg receptor-binding domain bound to gbo4 receptor
Class: structural protein
Keywords: PaG adhesin, GbO4, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, STRUCTURAL PROTEIN
Deposited on 2001-05-22, released 2001-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyelonephritic adhesin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1j8ra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j8rA (A:)
    wnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgfwayyrey
    iawvvfpkkvmtqngyplfievhnkgswseentgdndsyfflkgykwderafdagnlcqk
    pgeitrltekfddiifkvalpadlplgdysvkipytsgmqrhfasylgarfkipynvakt
    lprenemlflfknigg