PDB entry 1j8q

View 1j8q on RCSB PDB site
Description: Low Temperature (100K) Crystal Structure of Flavodoxin D. vulgaris Wild-type at 1.35 Angstrom Resolution
Class: electron transport
Keywords: alpha-helices, beta-sheet, electron transport
Deposited on 2001-05-22, released 2001-09-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.162
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
      • see remark 999 (0)
    Domains in SCOPe 2.01: d1j8qa_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j8qA (A:)
    akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai