PDB entry 1j8q

View 1j8q on RCSB PDB site
Description: Low Temperature (100K) Crystal Structure of Flavodoxin D. vulgaris Wild-type at 1.35 Angstrom Resolution
Deposited on 2001-05-22, released 2001-09-05
The last revision prior to the SCOP 1.71 freeze date was dated 2001-09-05, with a file datestamp of 2001-09-05.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.162
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1j8qa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j8qA (A:)
  akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
  ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
  dglridgdpraarddivgwahdvrgai