PDB entry 1j8m

View 1j8m on RCSB PDB site
Description: Signal Recognition Particle conserved GTPase domain from A. ambivalens
Class: signaling protein
Keywords: signaling protein
Deposited on 2001-05-22, released 2001-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: signal recognition 54 kda protein
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70722 (Start-291)
      • see remark 999 (9)
      • see remark 999 (164)
      • expression tag (292-296)
    Domains in SCOPe 2.06: d1j8mf1, d1j8mf2, d1j8mf3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1j8mF (F:)
    sklldnlrdtvrkfltgsssydkavedfikelqkslisadvnvklvfsltnkikerlkne
    kpptyierrewfikivydelsnlfggdkepkvipdkipyvimlvgvqgtgktttagklay
    fykkkgfkvglvgadvyrpaaleqlqqlgqqigvpvygepgekdvvgiakrgvekflsek
    meiiivdtagrhgygeeaalleemkniyeaikpdevtlvidasigqkaydlaskfnqask
    igtiiitkmdgtakgggalsavaatgatikfigtgekidelevfnprrfvarlhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j8mF (F:)
    lldnlrdtvrkfltgsssydkavedfikelqkslisadvnvklvfsltnkikerlknekp
    ptyierrewfikivydelsnlfggdkepkvipdkipyvimlvgvqgtgktttagklayfy
    kkkgfkvglvgadvyrpaaleqlqqlgqqigvpvygepgekdvvgiakrgvekflsekme
    iiivdtagrhgygeeaalleemkniyeaikpdevtlvidasigqkaydlaskfnqaskig
    tiiitkmdgtakgggalsavaatgatikfigtgekidelevfnprrfvarlhhhh