PDB entry 1j8k

View 1j8k on RCSB PDB site
Description: nmr structure of the fibronectin eda domain, nmr, 20 structures
Class: protein binding
Keywords: eda, fibronectin, typeiii domain, protein binding
Deposited on 2001-05-22, released 2002-02-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (0-93)
  Domains in SCOPe 2.05: d1j8ka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j8kA (A:)
  nidrpkglaftdvdvdsikiawespqgqvsryrvtysspedgihelfpapdgeedtaelq
  glrpgseytvsvvalhddmesqpligtqstaipa