PDB entry 1j8i

View 1j8i on RCSB PDB site
Description: solution structure of human lymphotactin
Deposited on 2001-05-21, released 2001-10-24
The last revision prior to the SCOP 1.69 freeze date was dated 2001-10-24, with a file datestamp of 2001-10-24.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1j8ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j8iA (A:)
    vgsevsdkrtcvslttqrlpvsriktytitegslravifitkrglkvcadpqatwvrdvv
    rsmdrksntrnnmiqtkptgtqqstntavtltg