PDB entry 1j8i

View 1j8i on RCSB PDB site
Description: Solution Structure of Human Lymphotactin
Class: cytokine
Keywords: Chemokine, CYTOKINE
Deposited on 2001-05-21, released 2001-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lymphotactin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P47992 (0-92)
  Domains in SCOPe 2.08: d1j8ia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j8iA (A:)
  vgsevsdkrtcvslttqrlpvsriktytitegslravifitkrglkvcadpqatwvrdvv
  rsmdrksntrnnmiqtkptgtqqstntavtltg