PDB entry 1j8e

View 1j8e on RCSB PDB site
Description: crystal structure of ligand-binding repeat cr7 from lrp
Deposited on 2001-05-21, released 2001-12-19
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-19, with a file datestamp of 2001-12-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1j8ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j8eA (A:)
    gshscsstqfkcnsgrcipehwtcdgdndcgdysdethanctnq