PDB entry 1j8c

View 1j8c on RCSB PDB site
Description: solution structure of the ubiquitin-like domain of hplic-2
Deposited on 2001-05-21, released 2002-03-20
The last revision prior to the SCOP 1.69 freeze date was dated 2002-03-20, with a file datestamp of 2002-03-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1j8ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j8cA (A:)
    maengessgpprpsrgpaaaqgsaaapaepkiikvtvktpkekeefavpenssvqqfkea
    iskrfksqtdqlvlifagkilkdqdtliqhgihdgltvhlvikrdpnsssvdkyaaaleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j8cA (A:)
    maengessgpprpsrgpaaaqgsaaapaepkiikvtvktpkekeefavpenssvqqfkea
    iskrfksqtdqlvlifagkilkdqdtliqhgihdgltvhlvik