PDB entry 1j8a

View 1j8a on RCSB PDB site
Description: crystal structure of benzamidine inhibited bovine pancreatic trypsin at 105k to 1.21a resolution from laboratory source with high number of waters modelled
Class: hydrolase
Keywords: protein-inhibitor complex, high number of waters, atomic resolution, hydrolase
Deposited on 2001-05-21, released 2001-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: 0.16
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsinogen, cationic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1j8aa_
  • Heterogens: CA, SO4, BEN, TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j8aA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn