PDB entry 1j84

View 1j84 on RCSB PDB site
Description: structure of fam17 carbohydrate binding module from clostridium cellulovorans with bound cellotetraose
Deposited on 2001-05-20, released 2001-12-12
The last revision prior to the SCOP 1.71 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.225
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1j84a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j84A (A:)
    qptapkdfssgfwdfndgttqgfgvnpdspitainvenannalkisnlnskgsndlsegn
    fwanvrisadiwgqsiniygdtkltmdviaptpvnvsiaaipqssthgwgnptrairvwt
    nnfvaqtdgtykatltistndspnfntiatdaadsvvtnmilfvgsnsdnisldnikftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j84A (A:)
    qptapkdfssgfwdfndgttqgfgvnpdspitainvenannalkisnlnskgsndlsegn
    fwanvrisadiwgqsiniygdtkltmdviaptpvnvsiaaipqssthgwgnptrairvwt
    nnfvaqtdgtykatltistndspnfntiatdaadsvvtnmilfvgsnsdnisldnikft