PDB entry 1j83

View 1j83 on RCSB PDB site
Description: structure of fam17 carbohydrate binding module from clostridium cellulovorans
Deposited on 2001-05-20, released 2001-12-12
The last revision prior to the SCOP 1.71 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1j83a_
  • Chain 'B':
    Domains in SCOP 1.71: d1j83b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j83A (A:)
    qptapkdfssgfwdfndgttqgfgvnpdspitainvenannalkisnlnskgsndlsegn
    fwanvrisadiwgqsiniygdtkltmdviaptpvnvsiaaipqssthgwgnptrairvwt
    nnfvaqtdgtykatltistndspnfntiatdaadsvvtnmilfvgsnsdnisldnikftk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j83B (B:)
    qptapkdfssgfwdfndgttqgfgvnpdspitainvenannalkisnlnskgsndlsegn
    fwanvrisadiwgqsiniygdtkltmdviaptpvnvsiaaipqssthgwgnptrairvwt
    nnfvaqtdgtykatltistndspnfntiatdaadsvvtnmilfvgsnsdnisldnikftk